
  • Product name
  • Description
    Rabbit polyclonal to C16orf78
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 107-156 (GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIV L) of Human C16orf78, NP_653203

  • Positive control
    • Fetal lung lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab83013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-C16orf78 antibody images

  • Anti-C16orf78 antibody (ab83013) at 1 µg/ml + Fetal lung lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 31 kDa
    Observed band size : 35 kDa (why is the actual band size different from the predicted?)

References for Anti-C16orf78 antibody (ab83013)

ab83013 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83013.
Please use the links above to contact us or submit feedback about this product.


Sign up