Overview

  • Product name
    Anti-C16orf88 antibody
  • Description
    Rabbit polyclonal to C16orf88
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: TAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQ QNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKL corresponding to amino acids 364-456 of Human C16orf88.

  • Positive control
    • Human stomach tissue; RT-4 and U-251 MG lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab126512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

WB 1/250 - 1/500. Predicted molecular weight: 52 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleoli and cytoplasm. Recommended concentration of ab126512 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab126512, at 1/50 dilution, staining C16orf88 in paraffin-embedded Human stomach by Immunohistochemistry.
  • All lanes : Anti-C16orf88 antibody (ab126512) at 1/250 dilution

    Lane 1 : RT-4 lysate
    Lane 2 : U-251 MG lysate
    Lane 3 : Human Plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate


    Predicted band size : 52 kDa
  • Immunohistochemical staining of Human kidney shows cytoplasmic positivity in tubular cells using ab126512

References

ab126512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up