Overview

  • Product nameAnti-C16orf9 antibody
    See all C16orf9 primary antibodies
  • Description
    Rabbit polyclonal to C16orf9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 431-480,

    RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA

    of Human C16orf9 (NP_114428).

  • Positive control
    • MCF7 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab102585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similaritiesBelongs to the ITFG3 family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI429612 antibody
    • Chromosome 16 open reading frame 9 antibody
    • DKFZp761D0211 antibody
    • FLJ32603 antibody
    • gs19 antibody
    • integrin alpha FG-GAP repeat containing 3 antibody
    • ITFG3 antibody
    • ITFG3_HUMAN antibody
    • MGC93756 antibody
    • OTTHUMP00000067161 antibody
    • Protein ITFG3 antibody
    • RGD1311484 antibody
    see all

Anti-C16orf9 antibody images

  • Anti-C16orf9 antibody (ab102585) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size : 60 kDa

References for Anti-C16orf9 antibody (ab102585)

ab102585 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"