Overview

  • Product name
  • Description
    Rabbit polyclonal to C17orf71
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 575-624 (

    HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF

    ) of Human C17orf71 (NP_060619).

  • Positive control
    • 721_B cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 110 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    C17orf71 belongs to the UPF0487 family. There are 3 isoforms produced by alternative splicing.
  • Database links
  • Alternative names
    • ABC 2 antibody
    • ABC2 antibody
    • Amplified in breast cancer gene 2 protein antibody
    • Chromosome 17 open reading antibody
    • chromosome 17 open reading frame 71 antibody
    • FLJ10587 antibody
    • Protein smg 8 homolog antibody
    • protein SMG8 antibody
    • SMG8 antibody
    • SMG8 protein antibody
    see all

Anti-C17orf71 antibody images

  • Anti-C17orf71 antibody (ab99060) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 110 kDa

References for Anti-C17orf71 antibody (ab99060)

ab99060 has not yet been referenced specifically in any publications.

Product Wall


I am sorry to hear that you have been having issues with these antibodies. Both ab82891 and ab99060 are covered by our Abpromise guarantee. According to Abpromise guarantee, since these products has been purchased within the last six months, we ar...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up