Anti-C17orf99 antibody - N-terminal (ab182475)

Overview

  • Product name
    Anti-C17orf99 antibody - N-terminal
    See all C17orf99 primary antibodies
  • Description
    Rabbit polyclonal to C17orf99 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Synthetic peptide within Human C17orf99 aa 59-108 (N terminal). The exact sequence is proprietary. (NP_001156547).
    Sequence:

    TYSLCGTKNIKVAKKVVKTHEPASFNLNVTLKSSPDLLTYFCWASSTSGA


    Database link: Q6UX52

  • Positive control
    • HeLa whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.

Target

Images

  • Anti-C17orf99 antibody - N-terminal (ab182475) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Predicted band size : 29 kDa

References

ab182475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up