Overview

  • Product nameAnti-C1orf110 antibody
    See all C1orf110 primary antibodies
  • Description
    Rabbit polyclonal to C1orf110
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (KVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED V) of human C1orf110 (NP_848645).

  • Positive control
    • human fetal heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe exact functions of C1orf110 remains unknown
  • Database links
  • Alternative names
    • Chromosome 1 open reading frame 110 antibody
    • Coiled coil domain containing protein C1orf110 antibody
    • FLJ41579 antibody
    • Hypothetical protein LOC339512 antibody
    • MGC48998 antibody
    • RP11-331H2.2 antibody
    see all

Anti-C1orf110 antibody images

  • Anti-C1orf110 antibody (ab87742) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa
    Observed band size : 28 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 38 kDa,88 kDa. We are unsure as to the identity of these extra bands.

References for Anti-C1orf110 antibody (ab87742)

ab87742 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"