Overview

  • Product name
    Anti-C1orf110 antibody
  • Description
    Rabbit polyclonal to C1orf110
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (KVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED V) of human C1orf110 (NP_848645).

  • Positive control
    • human fetal heart lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The exact functions of C1orf110 remains unknown
  • Database links
  • Alternative names
    • Chromosome 1 open reading frame 110 antibody
    • Coiled coil domain containing protein C1orf110 antibody
    • FLJ41579 antibody
    • Hypothetical protein LOC339512 antibody
    • MGC48998 antibody
    • RP11-331H2.2 antibody
    see all

Images

  • Anti-C1orf110 antibody (ab87742) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa
    Observed band size : 28 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 38 kDa,88 kDa. We are unsure as to the identity of these extra bands.

References

ab87742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up