Overview

  • Product nameAnti-C1orf131 antibody
  • Description
    Rabbit polyclonal to C1orf131
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPS V) of Human C1orf131, isoform 2 (NP_689592).

Properties

Applications

Our Abpromise guarantee covers the use of ab102612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links
  • FormThere are 4 isoforms produced by alternative splicing.
  • Alternative names
    • C1orf131 antibody
    • CA131_HUMAN antibody
    • Chromosome 1 open reading frame 131 antibody
    • DKFZp547B1713 antibody
    • Hypothetical protein LOC128061 antibody
    • OTTHUMP00000036145 antibody
    • OTTHUMP00000036146 antibody
    • RP4-609B14.1 antibody
    • Uncharacterized protein C1orf131 antibody
    see all

Anti-C1orf131 antibody images

  • Anti-C1orf131 antibody (ab102612) at 1 µg + Transfected 293T cells

    Predicted band size : 32 kDa

References for Anti-C1orf131 antibody (ab102612)

ab102612 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"