Overview

  • Product nameAnti-C1orf177 antibody
  • Description
    Rabbit polyclonal to C1orf177
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN L) of Human C1orf177 (NP_689820)

  • Positive control
    • 721_B cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe specific function of C1orf177 is not yet known.
  • Database links
  • Alternative names
    • Chromosome 1 open reading frame 177 antibody
    • FLJ40201 antibody
    • Hypothetical protein LOC163747 antibody
    • Uncharacterized protein C1orf177 antibody

Anti-C1orf177 antibody images

  • Anti-C1orf177 antibody (ab87303) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa
    Additional bands at : 80 kDa. We are unsure as to the identity of these extra bands.

References for Anti-C1orf177 antibody (ab87303)

ab87303 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"