
  • Product name
    Anti-C1orf177 antibody
  • Description
    Rabbit polyclonal to C1orf177
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN L) of Human C1orf177 (NP_689820)

  • Positive control
    • 721_B cell lysate.


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab87303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    The specific function of C1orf177 is not yet known.
  • Database links
  • Alternative names
    • Chromosome 1 open reading frame 177 antibody
    • FLJ40201 antibody
    • Hypothetical protein LOC163747 antibody
    • Uncharacterized protein C1orf177 antibody

Anti-C1orf177 antibody images

  • Anti-C1orf177 antibody (ab87303) at 1 µg/ml + 721_B cell lysate at 10 µg

    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa
    Additional bands at : 80 kDa. We are unsure as to the identity of these extra bands.

References for Anti-C1orf177 antibody (ab87303)

ab87303 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87303.
Please use the links above to contact us or submit feedback about this product.


Sign up