Overview

  • Product name
  • Description
    Rabbit polyclonal to C2
  • Tested applications
    Suitable for: Double Immunodiffusion, Immunodiffusion, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Full length native protein (purified) corresponding to Human C2 aa 21-752.
    Sequence:

    APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQW QTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHG DKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPAL GTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNLYLLLDCSQSVSENDF LIFKESASLMVDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVI SSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHA IILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSA NASDQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRV NVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIALLKLAQK VKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVAL NGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQE DESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL


    Database link: P06681

  • Positive control
    • Human plasma.

Properties

  • Form
    Lyophilised:Reconstitute the lyophilized antiserum by adding 1 ml sterile distilled water. Dilutions may be prepared by adding phosphate buffered saline (PBS, pH 7.2). If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance of the antiserum.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 99% PBS, EDTA

    No preservative added. No foreign proteins added.
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    Delipidated, heat inactivated, stable IgG fraction.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Double Immunodiffusion Use at an assay dependent concentration.

In double radial immunodiffusion use a rosette arrangement with 10 μl antiserum in 3 mm diameter center well and 2 μl plasma samples (neat and serially diluted) in 2 mm diameter peripheral wells.

Immunodiffusion Use at an assay dependent concentration.

Precipitin titre not less than 1/32 when tested against appropriate concentrations of purified C2 protein in agar-block immunodiffusion titration.

IP Use at an assay dependent concentration.

Target

  • Function
    Component C2 which is part of the classical pathway of the complement system is cleaved by activated factor C1 into two fragments: C2b and C2a. C2a, a serine protease, then combines with complement factor 4b to generate the C3 or C5 convertase.
  • Involvement in disease
    Defects in C2 are the cause of complement component 2 deficiency (C2D) [MIM:217000]. A deficiency of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus erythematosus. Skin and joint manifestations are common and renal disease is relatively rare. Patients with complement component 2 deficiency are also reported to have recurrent or invasive infections.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 3 Sushi (CCP/SCR) domains.
    Contains 1 VWFA domain.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARMD14 antibody
    • C2 antibody
    • C3/C5 convertase antibody
    • CO2 antibody
    • CO2_HUMAN antibody
    • Complement C2 antibody
    • Complement C2a fragment antibody
    • complement component 2 antibody
    • DKFZp779M0311 antibody
    see all

References

ab182961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up