
  • Product nameAnti-C2orf42 antibody
    See all C2orf42 primary antibodies
  • Description
    Rabbit polyclonal to C2orf42
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 469-518 (LFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKVGNTSPDQKEPTPF I) of Human C2orf42, NP_060350

  • Positive control
    • HepG2 Cell Lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab81310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:62500.


  • RelevanceThe exact function of C2orf42 remains unknown.
  • Database links
  • Alternative names
    • Chromosome 2 open reading frame 42 antibody
    • FLJ20558 antibody
    • hypothetical protein LOC54980 antibody

Anti-C2orf42 antibody images

  • Anti-C2orf42 antibody (ab81310) at 1 µg/ml (5% skim milk / PBS buffer) + HepG2 Cell Lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 64 kDa

References for Anti-C2orf42 antibody (ab81310)

ab81310 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81310.
Please use the links above to contact us or submit feedback about this product.