Overview

  • Product name
    Anti-C5R1 antibody [P12/1]
    See all C5R1 primary antibodies
  • Description
    Mouse monoclonal [P12/1] to C5R1
  • Specificity
    This antibody recognises the C5R1 receptor but does not inhibit the binding of C5a to its receptor.
  • Tested applications
    Suitable for: Flow Cyt, WB, IHC-Fr, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:

    MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN

    , corresponding to N terminal amino acids 1-31 of Human C5R1.

Properties

Applications

Our Abpromise guarantee covers the use of ab24036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/50 - 1/100. Use 10µl of this working solution to label 5 x 105 cells in 100µl



ab170191-Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.
WB Use at an assay dependent concentration. Predicted molecular weight: 39 kDa.
IHC-Fr Use at an assay dependent concentration.
IHC-P 1/200.

Target

  • Function
    Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Sulfation plays a critical role in the association of the receptor with C5a, but no significant role in the ability of the receptor to transduce a signal and mobilize calcium in response to a small peptide agonist.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANAPHYLATOXIN RECEPTOR antibody
    • C5a anaphylatoxin chemotactic receptor antibody
    • C5a anaphylatoxin receptor antibody
    • C5A antibody
    • C5a ligand antibody
    • C5a-R antibody
    • C5aR antibody
    • C5AR_HUMAN antibody
    • c5ar1 antibody
    • C5R1 antibody
    • CD88 antibody
    • CD88 antigen antibody
    • Complement component 5 receptor 1 antibody
    • Complement component 5 receptor 2 antibody
    • Complement component 5a receptor 1 antibody
    see all

References

This product has been referenced in:
  • Oppermann M  et al. Probing the human receptor for C5a anaphylatoxin with site-directed antibodies. Identification of a potential ligand binding site on the NH2-terminal domain. J Immunol 151:3785-94 (1993). Read more (PubMed: 8376805) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab24036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up