Overview

  • Product name
    Anti-C8orf72 antibody (FITC)
    See all C8orf72 primary antibodies
  • Description
    Rabbit polyclonal to C8orf72 (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human C8orf72 aa 1-370.
    Sequence:

    MPTETLQTGSMVKPVSPAGTFTSAVPLRILNKGPDYFRRQAEPNPKRLSA VERLEADKAKYVKSQEVINAKQEPVKPAVLAKPPVCPAAKRALGSPTLKV FGNHAKTESGVQRENLKLEILKNIINSSEGSSSGSGHKHSSRNWPPHRSE ATDLHRHSFAESLKVYPTQGRRSPQEGGSHVGRRLLEQSAESFLHVSHSS SDIRKVTSVKPLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGV SRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARAN SDIISLNFRSASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNAR IIKWLYSIKQARESQKVSHV


    Database link: Q8TC76

Properties

Applications

Our Abpromise guarantee covers the use of ab193109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 41 kDa.

Target

References

ab193109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up