Anti-C8orf76 antibody - N-terminal (ab177837)

Overview

  • Product name
    Anti-C8orf76 antibody - N-terminal
  • Description
    Rabbit polyclonal to C8orf76 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human C8orf76 aa 61-110 (N terminal). The exact sequence is proprietary. (NP_116236)
    Sequence:

    GDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHM


    Database link: Q96K31

  • Positive control
    • MDA-MB-435S whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Relevance
    C8orf76 is an uncharacterized protein.
  • Database links
  • Alternative names
    • C8orf76 antibody
    • Chromosome 8 open reading frame 76 antibody
    • Hypothetical protein LOC84933 antibody
    • LOC84933 antibody
    • Uncharacterized protein C8orf76 antibody
    see all

Images

  • Anti-C8orf76 antibody - N-terminal (ab177837) at 1 µg/ml + MDA-MB-435S whole cell lysate at 10 µg

    Predicted band size : 43 kDa

References

ab177837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up