Anti-PAXX antibody (ab126353)
Key features and details
- Rabbit polyclonal to PAXX
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PAXX antibody -
Description
Rabbit polyclonal to PAXX -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PAXX aa 109-204.
Sequence:LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGP QLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
-
Positive control
- IHC_P: Human pancreas, prostate and stomach tissue RT4, U251 MG, Human liver tissue and Human tonsil tissue lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab126353 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (5) |
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 22 kDa.
|
IHC-P |
1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 22 kDa. |
IHC-P
1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 286257 Human
- SwissProt: Q9BUH6 Human
- Unigene: 409582 Human
-
Alternative names
- C9orf142 antibody
- Chromosome 9 open reading frame 142 antibody
- CI142_HUMAN antibody
see all
Images
-
All lanes : Anti-PAXX antibody (ab126353) at 1/250 dilution
Lane 1 : RT4 cell lysate
Lane 2 : U251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 22 kDa -
ab126353 at a 1/1000 dilution staining PAXX in paraffin embedded Human pancreas tissue by immunohistochemistry.
-
Immunofluorescent staining of Human cell line U-251 MG shows positivity in nucleus but not nucleoli. Recommended concentration of ab126353 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemical analysis of human stomach tissue labeling PAXX with ab126353 at 1/2500 dilution.
-
Immunohistochemical analysis of human prostate tissue labeling PAXX with ab126353 at 1/2500 dilution.
-
Immunohistochemical analysis of human skeletal muscle tissue labeling PAXX with ab126353 at 1/2500 dilution. No positivity seen in myocytes as expected.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab126353 has been referenced in 15 publications.
- Koike M et al. Feline XRCC4 undergoes rapid Ku-dependent recruitment to DNA damage sites. FEBS Open Bio 12:798-810 (2022). PubMed: 35000298
- Hepburn M et al. The active DNA-PK holoenzyme occupies a tensed state in a staggered synaptic complex. Structure 29:467-478.e6 (2021). PubMed: 33412091
- Hart M et al. Multinucleation associated DNA damage blocks proliferation in p53-compromised cells. Commun Biol 4:451 (2021). PubMed: 33837239
- Ruis B et al. Absence of XRCC4 and its paralogs in human cells reveal differences in outcomes for DNA repair and V(D)J recombination. DNA Repair (Amst) 85:102738 (2020). PubMed: 31731258
- Craxton A et al. PAXX and its paralogs synergistically direct DNA polymerase ? activity in DNA repair. Nat Commun 9:3877 (2018). PubMed: 30250067