Overview

  • Product nameAnti-C9orf152 antibody
    See all C9orf152 primary antibodies
  • Description
    Rabbit polyclonal to C9orf152
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (

    MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK

    ) of Human C9orf152 (NP_001374).

  • Positive control
    • THP-1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab101976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-C9orf152 antibody images

  • Anti-C9orf152 antibody (ab101976) at 1 µg/ml + THP-1 cell lysate at 10 µg
    Developed using the ECL technique

    Predicted band size : 26 kDa

References for Anti-C9orf152 antibody (ab101976)

ab101976 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"