
  • Product nameAnti-C9ORF4 antibody
  • Description
    Rabbit polyclonal to C9ORF4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264, (HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNV P) of Human C9ORF4 (NP_055149)

  • Positive control
    • ACHN cell lysate.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab98878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-C9ORF4 antibody images

  • Anti-C9ORF4 antibody (ab98878) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 37 kDa

References for Anti-C9ORF4 antibody (ab98878)

ab98878 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98878.
Please use the links above to contact us or submit feedback about this product.