Overview

  • Product name
    Anti-C9ORF46 antibody
  • Description
    Rabbit polyclonal to C9ORF46
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 72-121 (

    AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL

    ) of human C9orf46 (NP_060935).

  • Positive control
    • Human fetal heart lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Rabbit Ig G is purified by peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay, 1:312500.

Target

  • Relevance
    The exact function of C9ORF46 remains unknown.
  • Cellular localization
    Membrane; Multi pass membrane protein
  • Database links
  • Alternative names
    • AD025 antibody
    • Chromosome 9 open reading frame 46 antibody
    • FLJ14688 antibody
    • FLJ39176 antibody
    • Hypothetical protein LOC55848 antibody
    • MDS030 antibody
    • transmembrane protein C9orf46 antibody
    • Uncharacterized hematopoietic stem/progenitor cells protein MDS030 antibody
    see all

Images

  • Anti-C9ORF46 antibody (ab82868) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted at 1/50000 dilution

    Predicted band size : 17 kDa
    Observed band size : 17 kDa

References

ab82868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up