Overview

  • Product nameAnti-C9ORF46 antibody
  • Description
    Rabbit polyclonal to C9ORF46
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 72-121 (

    AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL

    ) of human C9orf46 (NP_060935).

  • Positive control
    • Human fetal heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesRabbit Ig G is purified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay, 1:312500.

Target

  • RelevanceThe exact function of C9ORF46 remains unknown.
  • Cellular localizationMembrane; Multi pass membrane protein
  • Database links
  • Alternative names
    • AD025 antibody
    • Chromosome 9 open reading frame 46 antibody
    • FLJ14688 antibody
    • FLJ39176 antibody
    • Hypothetical protein LOC55848 antibody
    • MDS030 antibody
    • transmembrane protein C9orf46 antibody
    • Uncharacterized hematopoietic stem/progenitor cells protein MDS030 antibody
    see all

Anti-C9ORF46 antibody images

  • Anti-C9ORF46 antibody (ab82868) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted at 1/50000 dilution

    Predicted band size : 17 kDa
    Observed band size : 17 kDa

References for Anti-C9ORF46 antibody (ab82868)

ab82868 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"