Overview

  • Product nameAnti-C9orf68 antibody
    See all C9orf68 primary antibodies
  • Description
    Rabbit polyclonal to C9orf68
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 288-337 (LDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG S) of Human C9orf68 (NP_001034484).

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab94439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe function of this protein is still undiscovered.
  • Database links
  • Alternative names
    • bA6J24.2 antibody
    • chromosome 9 open reading frame 68 antibody
    • FLJ10058 antibody
    • RP11-280I16.2 antibody
    • Uncharacterized protein C9orf68 antibody
    see all

Anti-C9orf68 antibody images

  • Anti-C9orf68 antibody (ab94439) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa

References for Anti-C9orf68 antibody (ab94439)

ab94439 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"