Overview

  • Product name
    Anti-CABYR antibody
  • Description
    Rabbit polyclonal to CABYR
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human CABYR aa 345-390.
    Sequence:

    KSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDT


    Database link: O75952-6

  • Positive control
    • HeLa, sp2/0 and PC12 whole cell lysates

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192403 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 53 kDa.

Target

  • Function
    May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction. Isoform 1 binds calcium in vitro. Isoform 2 and isoform 6 probably bind calcium. Isoform 3 and isoform 5 do not bind calcium in vitro. Isoform 4 probably does not bind calcium.
  • Tissue specificity
    Expressed in elongating spermatids and spermatozoa (at protein level). Isoform 1 is expressed in testis. Isoform 3 and isoform 5 are also expressed in brain, pancreas and numerous brain tumors.
  • Sequence similarities
    Contains 1 RIIa domain.
  • Post-translational
    modifications
    Isoform 1 is phosphorylated on tyrosine residues during in vitro capacitation. Isoform 3 and isoform 5 are phosphorylated by GSK3B in vitro. Dephosphorylation affects its ability to bind calcium.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > cilium > flagellum. Localized to fibrous sheath including the surface of the longitudinal columns and ribs of the principal piece of sperm flagella and Nucleus. Cytoplasm. Cell projection > cilium > flagellum. According to PubMed:15752768, isoform 1, isoform 3 and isoform 5 are both nuclear and cytoplasmic.
  • Information by UniProt
  • Database links
  • Alternative names
    • CABYR antibody
    • CABYR_HUMAN antibody
    • Calcium binding tyrosine-(Y)-phosphorylation regulated antibody
    • Calcium-binding protein 86 antibody
    • Calcium-binding tyrosine phosphorylation-regulated protein antibody
    • Cancer/testis antigen 88 antibody
    • CBP86 antibody
    • CT88 antibody
    • Fibrousheathin II antibody
    • Fibrousheathin-2 antibody
    • FSP-2 antibody
    • FSP2 antibody
    • Testis-specific calcium-binding protein CBP86 antibody
    see all

Images

  • All lanes : Anti-CABYR antibody (ab192403) at 1/500 dilution

    Lane 1 : HeLa whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : PC12 whole cell lysate


    Predicted band size : 53 kDa

References

ab192403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up