Overview

  • Product name
    CACHD1 peptide

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Sequence
      HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
    • Molecular weight
      137 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab106724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-CACHD1 antibody (ab75141)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • CACHD1
    • Cache domain containing protein 1
    • Cache domain-containing protein 1
    • CAHD1_HUMAN
    • von Willebrand factor type A and cache domain containing 1
    • VWCD1
    • VWFA and cache domain-containing protein 1
    see all
  • Function
    May regulate voltage-dependent calcium channels.
  • Sequence similarities
    Belongs to the calcium channel subunit alpha-2/delta family.
    Contains 2 cache domains.
    Contains 1 VWFA domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References for CACHD1 peptide (ab106724)

ab106724 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up