Overview

  • Product nameAnti-Calcitonin antibody
    See all Calcitonin primary antibodies
  • Description
    Sheep polyclonal to Calcitonin
  • SpecificityThere were no cross reactivities obtained with human Katacalcin and human Calcitonin Gene related Peptide
  • Tested applicationsSuitable for: RIAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:

    CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP

    conjugated to BSA, corresponding to amino acids 85-107 of Human Calcitonin.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab14171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
RIA 1/80000.

Target

  • RelevanceCalcitonin is a 32 amino acid peptide hormone synthesized by the parafollicular cells of the thyroid. It causes a rapid, but short lived, reduction in serum calcium and phosphate by promoting the incorporation of those ions in the bones. This effect is opposite to that of parathyroid hormone. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
  • Cellular localizationCytoplasmic and Secreted
  • Database links
  • Alternative names
    • Alpha CGRP antibody
    • alpha type CGRP antibody
    • CALC 1 antibody
    • CALC A antibody
    • CALC1 antibody
    • calcitonin 1 antibody
    • calcitonin gene related peptide 1 antibody
    • calcitonin gene related peptide I antibody
    • calcitonin related polypeptide alpha antibody
    • CGRP 1 antibody
    • CGRP antibody
    • CGRP I antibody
    • CGRP1 antibody
    • CT antibody
    • katacalcin antibody
    • KC antibody
    see all

References for Anti-Calcitonin antibody (ab14171)

ab14171 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab14171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"