Anti-Calcium Pump PMCA4 ATPase antibody (ab84895)

Overview

  • Product name
    Anti-Calcium Pump PMCA4 ATPase antibody
    See all Calcium Pump PMCA4 ATPase primary antibodies
  • Description
    Rabbit polyclonal to Calcium Pump PMCA4 ATPase
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 936-985 (

    FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK

    ) of Human Calcium Pump PMCA4 ATPase (NP_001001396).

  • Positive control
    • 721_B Cell Lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab84895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 130 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
  • Tissue specificity
    Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AT2B4_HUMAN antibody
    • ATP2B2 antibody
    • Atp2b4 antibody
    • ATPase Ca++ transporting plasma membrane 4 antibody
    • Cation transporting ATPase antibody
    • DKFZp686G08106 antibody
    • DKFZp686M088 antibody
    • Matrix remodelling associated 1 antibody
    • Matrix remodelling associated protein 1 antibody
    • Matrix-remodeling-associated protein 1 antibody
    • MXRA 1 antibody
    • MXRA1 antibody
    • OTTHUMP00000034088 antibody
    • OTTHUMP00000034089 antibody
    • Plasma membrane calcium ATPase 4 antibody
    • Plasma membrane calcium ATPase isoform 4 antibody
    • Plasma membrane calcium pump isoform 4 antibody
    • Plasma membrane calcium transporting ATPase 4 antibody
    • Plasma membrane calcium-transporting ATPase 4 antibody
    • PMCA 4 antibody
    • PMCA4 antibody
    • PMCA4b antibody
    • PMCA4x antibody
    • Sarcolemmal calcium pump antibody
    see all

Images

  • Anti-Calcium Pump PMCA4 ATPase antibody (ab84895) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 130 kDa
    Observed band size : 120 kDa (why is the actual band size different from the predicted?)

References

ab84895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up