Overview

  • Product nameAnti-CAMK 1D beta antibody
  • Description
    Rabbit polyclonal to CAMK 1D beta
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide:

    SSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFA

    conjugated to KLH, corresponding to N terminal amino acids 10-50 of Human CAMK 1D beta.

  • Positive control
    • Human brain tissue lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 0.2% Gelatin, PBS
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • RelevanceThis gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • Calcium/calmodulin dependent protein kinase ID antibody
    • CaM K1 antibody
    • CaM KI delta antibody
    • CaM kinase I delta antibody
    • CaM kinase ID antibody
    • Camk1D antibody
    • CaMKI delta antibody
    • CamKI like protein kinase antibody
    • CaMKID antibody
    • CKLiK antibody
    • EC 2.7.11.17 antibody
    see all

Anti-CAMK 1D beta antibody images

  • Anti-CAMK 1D beta antibody (ab22043) at 2 µg/ml

    Performed under reducing conditions.

    Predicted band size : 43 kDa

References for Anti-CAMK 1D beta antibody (ab22043)

ab22043 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab22043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"