Overview

  • Product nameAnti-CAPZA3 antibody
    See all CAPZA3 primary antibodies
  • Description
    Rabbit polyclonal to CAPZA3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (TLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC A) of Human CAPZA3 (NP_201585)

  • Positive control
    • DU145 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab89978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceCAPZA3 belongs to the F actin capping protein alpha subunit family. It is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. It may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.
  • Database links
  • Alternative names
    • 510-4 antibody
    • Cap protein, actin, alpha-3 subunit antibody
    • CAPAA3 antibody
    • CAPPA3 antibody
    • Capping protein (actin filament) muscle Z line, alpha 3 antibody
    • Capping protein, alpha-3 antibody
    • CapZ alpha 3 antibody
    • Capza3 antibody
    • CP alpha 3 antibody
    • F actin capping protein alpha 3 subunit antibody
    • F actin capping protein subunit alpha 3 antibody
    • Germ cell specific protein 3 antibody
    • GSG3 antibody
    • MGC133890 antibody
    • repro32 antibody
    • Tex8 antibody
    see all

Anti-CAPZA3 antibody images

  • Anti-CAPZA3 antibody (ab89978) at 1 µg/ml + DU145 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 35 kDa

References for Anti-CAPZA3 antibody (ab89978)

ab89978 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"