Carbamylated Bovine Serum Albumin protein (ab172196)

Overview

  • Product name
    Carbamylated Bovine Serum Albumin protein
  • Protein length
    Full length protein

Description

  • Nature
    Native
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Cow
    • Sequence
      MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIA FSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCK VASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEF KADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC LLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAE FVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFL GSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKL KHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVS RSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCC TESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKK QTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKL VVSTQTALA
    • Molecular weight
      69 kDa
    • Amino acids
      1 to 607
    • Additional sequence information
      Modified by carbamylation Source = Bovine Serum Albumin modified by carbamylation

Specifications

Our Abpromise guarantee covers the use of ab172196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Preservative: 0.01% Sodium azide
    Constituents: 0.88% Sodium chloride, 0.015% EDTA, 50% Glycerol, 49% PBS

General Info

  • Alternative names
    • BSA
    • serum albumin
  • Relevance
    Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca2+, Na+, K+, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
  • Cellular localization
    Secreted

References

ab172196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up