Anti-Carbohydrate sulfotransferase 1 antibody (ab98857)

Overview

  • Product nameAnti-Carbohydrate sulfotransferase 1 antibody
  • Description
    Rabbit polyclonal to Carbohydrate sulfotransferase 1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Carbohydrate sulfotransferase 1 aa 251-300 (internal sequence).
    Sequence:

    YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

  • Positive control
    • Fetal cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. May function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. Participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
  • Tissue specificityWidely expressed at low level. Expressed in brain and skeletal muscle. Expressed by high endothelial cells (HEVs) and leukocytes.
  • Sequence similaritiesBelongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Carbohydrate chondroitin 6 keratan sulfotransferase 1 antibody
    • Carbohydrate chondroitin 6 keratan sulfotransferase antibody
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase antibody
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase 1 antibody
    • Carbohydrate sulfotransferase 1 antibody
    • Chst1 antibody
    • CHST1_HUMAN antibody
    • EC 2.8.2.21 antibody
    • Galactose N acetylglucosamine N acetylglucosamine 6 O sulfotransferase 1 antibody
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1 antibody
    • GST 1 antibody
    • GST-1 antibody
    • Keratan sulfate Gal 6 sulfotransferase antibody
    • Keratan sulfate Gal-6 sulfotransferase antibody
    • KS6ST antibody
    • KSGal6ST antibody
    • KSST antibody
    see all

Anti-Carbohydrate sulfotransferase 1 antibody images

  • Anti-Carbohydrate sulfotransferase 1 antibody (ab98857) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size : 47 kDa
    Gel concentration: 12%

References for Anti-Carbohydrate sulfotransferase 1 antibody (ab98857)

ab98857 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"