Anti-Carbonic Anhydrase I antibody (Biotin) (ab182891)

Overview

  • Product name
    Anti-Carbonic Anhydrase I antibody (Biotin)
    See all Carbonic Anhydrase I primary antibodies
  • Description
    Rabbit polyclonal to Carbonic Anhydrase I (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: ICC, WB, ELISA, Dot blot, IHC-Pmore details
  • Species reactivity
    Reacts with: Cow
  • Immunogen

    Full length native protein (purified) corresponding to Cow Carbonic Anhydrase I aa 2-261. Carbonic anhydrase from Bovine erythrocytes.
    Sequence:

    ASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVS YNPATAKEIVNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGIT DDCGSEHLVDGAKFSAELHLVHWNSAKYPSFADAASQADGLALIGVLVKV GQANPNLQKVLDALKAVKNKNKKAPFTNFDPSVLLPPSLDYWAYSGSLTH PPLHESVTWIIFKETISVSSEQLAQFRSLLANAEGDREVHIKQNNRPPQP LNGRTVKASF


    Database link: Q1LZA1

Properties

  • Form
    Lyophilised:Add 1.0 ml sterile distilled water.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    IgG fraction
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 29 kDa.
ELISA Use at an assay dependent concentration.
Dot blot Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • CA 1 antibody
    • CA I antibody
    • CA-I antibody
    • CA1 antibody
    • CAB antibody
    • CAH1_HUMAN antibody
    • CAI antibody
    • CAN antibody
    • Car 1 antibody
    • Car1 antibody
    • Carbonate dehydratase I antibody
    • Carbonic anhydrase 1 antibody
    • Carbonic anhydrase A antibody
    • Carbonic anhydrase B antibody
    • Carbonic anhydrase B, formerly antibody
    • Carbonic anhydrase I antibody
    • Carbonic dehydratase antibody
    • ECK0125 antibody
    • JW0122 antibody
    • yadF antibody
    see all

References

ab182891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up