Anti-Carbonic Anhydrase I antibody (HRP) (ab181687)

Overview

  • Product name
    Anti-Carbonic Anhydrase I antibody (HRP)
    See all Carbonic Anhydrase I primary antibodies
  • Description
    Goat polyclonal to Carbonic Anhydrase I (HRP)
  • Host species
    Goat
  • Conjugation
    HRP
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Full length native protein (purified) corresponding to Human Carbonic Anhydrase I aa 2-261. (Purified from Erythrocytes).
    Sequence:

    ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS YNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGST NEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKV GEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTH PPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQP LKGRTVRASF


    Database link: P00915

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    pH: 7.20
    Preservative: 0.01% Gentamicin sulphate
    Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate, 1% BSA

    Do NOT add Sodium Azide!
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    ab181687 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/2500.
WB 1/1000 - 1/5000. Predicted molecular weight: 28 kDa.

Target

  • Function
    Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • CA 1 antibody
    • CA I antibody
    • CA-I antibody
    • CA1 antibody
    • CAB antibody
    • CAH1_HUMAN antibody
    • CAI antibody
    • CAN antibody
    • Car 1 antibody
    • Car1 antibody
    • Carbonate dehydratase I antibody
    • Carbonic anhydrase 1 antibody
    • Carbonic anhydrase A antibody
    • Carbonic anhydrase B antibody
    • Carbonic anhydrase B, formerly antibody
    • Carbonic anhydrase I antibody
    • Carbonic dehydratase antibody
    • ECK0125 antibody
    • JW0122 antibody
    • yadF antibody
    see all

References

ab181687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up