Anti-Carbonic Anhydrase III antibody (ab175309)

Overview

  • Product name
    Anti-Carbonic Anhydrase III antibody
    See all Carbonic Anhydrase III primary antibodies
  • Description
    Rabbit polyclonal to Carbonic Anhydrase III
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Horse, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Carbonic Anhydrase III aa 1-260.
    Sequence:

    MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFK


    Database link: P07451

  • Positive control
    • HeLa and 293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab175309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 30 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase III with ab175309 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase III with ab175309 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175309. Blue DAPI for nuclear staining.
  • All lanes : Anti-Carbonic Anhydrase III antibody (ab175309) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 293 cell lysate

    Predicted band size: 30 kDa

References

ab175309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up