Anti-Carbonic Anhydrase IX antibody (ab15086)

Overview

  • Product name
    Anti-Carbonic Anhydrase IX antibody
    See all Carbonic Anhydrase IX primary antibodies
  • Description
    Rabbit polyclonal to Carbonic Anhydrase IX
  • Tested applications
    Suitable for: IHC-P, Flow Cyt, IHC-Fr, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Carbonic Anhydrase IX aa 359-459.
    Sequence:

    LSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNS CLAAGDILALVFGLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETG A


    Database link: Q16790
    (Peptide available as ab109840)

  • Positive control
    • IHC-Fr: Human colorectal tumor tissue. IHC-P: Canine gastric mucosa tissue. WB: Ramos (human Burkitt's lymphoma cell line) Whole Cell Lysate and A549 (human lung adenocarcinoma epithelial cell line) Whole Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab15086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. Citrate Buffer (pH 6.0)
Flow Cyt Use at an assay dependent concentration. PubMed: 25269858

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

IHC-Fr Use at an assay dependent concentration. PubMed: 20515941Slides were fixed in acetone for 20 minutes.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 55 kDa (predicted molecular weight: 49.7 kDa).Can be blocked with Recombinant Human RND1 protein (ab109840).

Target

  • Function
    Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
  • Tissue specificity
    Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Post-translational
    modifications
    Asn-346 bears high-mannose type glycan structures.
  • Cellular localization
    Nucleus. Nucleus, nucleolus. Cell membrane. Cell projection, microvillus membrane. Found on the surface microvilli and in the nucleus, particularly in nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CA-IX antibody
    • CA9 antibody
    • CAH9_HUMAN antibody
    • CAIX antibody
    • Carbonate dehydratase IX antibody
    • Carbonic anhydrase 9 antibody
    • Carbonic anhydrase IX antibody
    • Carbonic dehydratase antibody
    • G250 antibody
    • Membrane antigen MN antibody
    • MN antibody
    • P54/58N antibody
    • pMW1 antibody
    • RCC associated protein G250 antibody
    • RCC-associated antigen G250 antibody
    • Renal cell carcinoma-associated antigen G250 antibody
    see all

Images

  • Formaldehyde fixed, PBS/ 0.3% Triton X-100 permeabilized frozen human colorectal tumor tissue stained for Carbonic Anhydrase IX using ab15086 (green) at a 1/1000 dilution. 5% serum used for blocking for 1 hour at RT. Primary incubation time 3 hours at RT in PBS/ 0.3% Triton X-100/ 1% BSA. Secondary: Goat polyclonal conjugated to AlexaFluor® 488 used at a 1/2000 dilution.

    See Abreview

  • All lanes : Anti-Carbonic Anhydrase IX antibody (ab15086) at 1 µg/ml

    Lane 1 : Ramos (Human Burkitt's lymphoma cell line) Whole Cell Lysate
    Lane 2 : A549 (Human lung adenocarcinoma epithelial cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Predicted band size : 49.7 kDa
    Observed band size : 55 kDa (why is the actual band size different from the predicted?)
  • ab15086 at 1/500 staining dog gastric mucosa tissue sections by IHC-P. The tissue was formaldehyde fixed and a standard citrate buffer was used for anitgen retrieval. The tissue was blocked with 10% serum prior to incubation with the antibody for 15 hours. A biotinylated donkey anti-rabbit IgG (H + L) was used as the secondary.

    See Abreview

References

This product has been referenced in:
  • Veyrat M  et al. Stimulation of the toll-like receptor 3 promotes metabolic reprogramming in head and neck carcinoma cells. Oncotarget 7:82580-82593 (2016). IHC-P ; Human . Read more (PubMed: 27791989) »
  • Eom KY  et al. The Expression of Carbonic Anhydrase (CA) IX/XII and Lymph Node Metastasis in Early Breast Cancer. Cancer Res Treat 48:125-32 (2016). IHC-P ; Human . Read more (PubMed: 25761481) »

See all 60 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
Sample
Human Tissue sections (Colorectal tumors)
Specification
Colorectal tumors
Permeabilization
Yes - 1xPBS+0.3%t-X-100
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 09 2014

Thank you for contacting us.

We have several HIF antibodies in our catalog that react with mouse. For example, ab8366: HIF1 alpha, ab199: HIF2 alpha, ab10134: HIF3 alpha, ab465: HIF1 beta. If you could let me know which HIF you are looking fo...

Read More

Thank you for contacting us. Unfortunately we do not have any kit corresponding to the detection of the CAIX protein. However, I would suggest to develop an ELISA assay using the CAIX protein ab114200 that would be coated on the plate. A control ...

Read More

Thank you for your patient. Unfortunately there is no number that I can provide to you as it is impossible to know for sure how many slides you will be able to stain with a vial. This will depend on the experimental conditions, the samples and how high...

Read More

Thank you for contacting us. The concentration which is recommended for performing IHC-P with Anti-Carbonic Anhydrase IX antibody (ab15086) is 1/1000-1/2000. Taking the more concentrated range, I have estimated that from the 100µl provided (and inc...

Read More

Thank you for your reply. It seems from your description that you are doing everything fine. If I understand correctly, you are using the peptide at 1 ug/mL and the antibody at 0.1 ug/mL (1/10,000 dilution). At same volumes, the peptid...

Read More
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (Soft Tissue Sarcoma, Gastric Mucosa)
Specification
Soft Tissue Sarcoma, Gastric Mucosa
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10%
Username

Abcam user community

Verified customer

Submitted Dec 13 2006

Thank you for your enquiry. I enquired with our source for this antibody and there have not been any reports of this problem where the antibody is staining muscle. Ab15086 was characterized for use in IHC with renal carcinoma tissue and I would recomme...

Read More

Thank you for your enquiry. The immunogen is a synthetic peptide made to a sequence within residues 359-459 of the human protein (the C-terminus), accession# Q16790. The exact sequence is proprietary information and cannot be disclosed. I hope...

Read More

Thank you for your enquiry and your interest in our products. According to Swiss-Prot database this Carbonic Anhydrase IX can be found on the surface microvilli and in the nucleus.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up