Anti-Carboxypeptidase Y antibody (ab181691)

Overview

  • Product name
    Anti-Carboxypeptidase Y antibody
    See all Carboxypeptidase Y primary antibodies
  • Description
    Rabbit polyclonal to Carboxypeptidase Y
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Sandwich ELISA, WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Full length native protein (purified) corresponding to Saccharomyces cerevisiae Carboxypeptidase Y aa 112-532.
    Sequence:

    KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWL NGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVG FSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGH YIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPS VLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQR TGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNF DINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWT DVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVP FDVPENALSMVNEWIHGGFS L


    Database link: P00729

  • Positive control
    • S. cerevisiae Carboxypeptidase Y protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab181691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA 1/10000 - 1/42000.

ab181691 has been assayed against 1.0 µg of S. cerevisiae Carboxypeptidase Y in a standard sandwich ELISA using peroxidase conjugated affinity purified anti-rabbit IgG [H&L] (goat) and (ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at room temperature.

WB 1/1000 - 1/5000. Detects a band of approximately 57 kDa (predicted molecular weight: 60 kDa).

Target

  • Function
    Involved in degradation of small peptides. Digests preferentially peptides containing an aliphatic or hydrophobic residue in P1' position, as well as methionine, leucine or phenylalanine in P1 position of ester substrate.
  • Sequence similarities
    Belongs to the peptidase S10 family.
  • Post-translational
    modifications
    Enters the endoplasmic reticulum as an inactive zymogen and is modified by four N-linked core oligosaccharides, giving rise to a precursor known as P1 (67 kDa). As P1 transits through the Golgi, extension of its core oligosaccharides leads to the Golgi-modified P2 precursor (69 kDa). P2 is sorted away from secretory proteins at or beyond a late Golgi compartment and is subsequently delivered to the vacuole via a prevacuolar endosome-like compartment. Upon arrival in the vacuole, the N-terminal prosegment of P2 is cleaved to yield the enzymatically active mature vacuolar form of CPY (61 kDa).
  • Cellular localization
    Vacuole. Lysosome-like vacuoles.
  • Information by UniProt
  • Database links
    • Alternative names
      • carboxypeptidase C PRC1 antibody
      • Carboxypeptidase Y antibody
      • Carboxypeptidase YSCY antibody
      • CBPY_YEAST antibody
      • CPY antibody
      • LBC1 antibody
      • PRC1 antibody
      • Vacuolar carboxypeptidase Y antibody
      see all

    Images

    • Anti-Carboxypeptidase Y antibody (ab181691) at 1/1000 dilution + S. cerevisiae Carboxypeptidase Y at 0.05 µg

      Secondary
      Peroxidase rabbit at 1/40000 dilution

      Developed using the ECL technique.

      Predicted band size: 60 kDa
      Observed band size: 57 kDa (why is the actual band size different from the predicted?)

    References

    ab181691 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab181691.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up