Overview

  • Product name
  • Description
    Mouse Polyclonal to CARD15
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Full length protein corresponding to Human CARD15 aa 1-1040.
    Sequence:

    MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSL EGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWAC QKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVE NMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLL QHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLED IYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLF EHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDP TSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQ GIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELL LQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHL GRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQ ASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKAL LRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQ EERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYN SVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLAL FNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALM LAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGA EALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL


    Database link: AAI56572.1

  • Positive control
    • CARD15-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 115 kDa.

Target

  • Function
    Induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS).
  • Tissue specificity
    Monocytes-specific.
  • Involvement in disease
    Defects in NOD2 are the cause of Blau syndrome (BS) [MIM:186580]. BS is a rare autosomal dominant disorder characterized by early-onset granulomatous arthritis, uveitis and skin rash.
    Defects in NOD2 are a cause of susceptibility to inflammatory bowel disease type 1 (IBD1) [MIM:266600]. IBD1 is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
    Defects in NOD2 are the cause of sarcoidosis early-onset (EOS) [MIM:609464]. EOS is a form of sarcoidosis manifesting in children younger than 4 years of age. Sarcoidosis is an idiopathic, systemic, inflammatory disease characterized by the formation of immune granulomas in involved organs. Granulomas predominantly invade the lungs and the lymphatic system, but also skin, liver, spleen, eyes and other organs may be involved. Early-onset sarcoidosis is quite rare and has a distinct triad of skin, joint and eye disorders, without apparent pulmonary involvement. Compared with an asymptomatic and sometimes naturally disappearing course of the disease in older children, early-onset sarcoidosis is progressive and in many cases causes severe complications, such as blindness, joint destruction and visceral involvement.
  • Sequence similarities
    Contains 2 CARD domains.
    Contains 9 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACUG antibody
    • Arthrocutaneouveal granulomatosis antibody
    • BLAU antibody
    • CARD15 antibody
    • Caspase recruitment domain family, member 15 antibody
    • Caspase recruitment domain protein 15 antibody
    • Caspase recruitment domain-containing protein 15 antibody
    • CD antibody
    • CLR16.3 antibody
    • IBD1 antibody
    • Inflammatory bowel disease protein 1 antibody
    • LRR containing protein antibody
    • NLR family, CARD domain containing 2 antibody
    • NLRC2 antibody
    • NOD like receptor C2 antibody
    • NOD2 antibody
    • NOD2 protein antibody
    • NOD2_HUMAN antibody
    • NOD2B antibody
    • nucleotide binding oligomerization domain 2 antibody
    • Nucleotide binding oligomerization domain containing 2 antibody
    • Nucleotide binding oligomerization domain, leucine rich repeat and CARD domain containing 2 antibody
    • Nucleotide-binding oligomerization domain-containing protein 2 antibody
    • PSORAS1 antibody
    see all

Images

  • All lanes : Anti-CARD15 antibody (ab172755) at 1 µg/ml

    Lane 1 : CARD15-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 115 kDa

References

ab172755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up