Overview

  • Product name
  • Description
    Mouse polyclonal to Casein
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Casein aa 1-185. Swissprot: P47710
    Sequence:

    MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMN RQRNILREKQTDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCA EQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVW YYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW


    Database link: NP_001881.1

  • Positive control
    • Casein-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Function
    Important role in the capacity of milk to transport calcium phosphate.
    Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors.
  • Tissue specificity
    Mammary gland specific. Secreted in milk.
  • Sequence similarities
    Belongs to the alpha-casein family.
  • Post-translational
    modifications
    Not glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha casein antibody
    • alpha-S1-casein antibody
    • CASA antibody
    • CASA1_HUMAN antibody
    • Casein alpha s1 antibody
    • casein, alpha antibody
    • casein, alpha-S1, included antibody
    • Casoxin-D antibody
    • CSN1 antibody
    • CSN1S1 antibody
    • Csna antibody
    • MGC149368 antibody
    see all

Images

  • All lanes : Anti-Casein antibody (ab171856) at 1 µg/ml

    Lane 1 : Casein-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 22 kDa

References

ab171856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up