Overview

  • Product name
    Anti-Caspase 2 antibody
  • Description
    Rabbit polyclonal to Caspase 2
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Caspase 2 aa 1-201. BC002427
    Sequence:

    MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQ LLLSELLEHL LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQA FDAFCEALRETKQGHLEDMLLT TLSGLQHVLPPLSCDYDLSLPFPVCE SCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCT PEFYQTHFQLAYRL QSRPRGL


    Database link: P42575

  • Positive control
    • Human fetal kidney and lung tissue lysate; Human urinary bladder tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab182657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/300.
WB 1/1000 - 1/2000. Predicted molecular weight: 51 kDa.

Target

  • Function
    Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.
  • Tissue specificity
    Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
  • Sequence similarities
    Belongs to the peptidase C14A family.
    Contains 1 CARD domain.
  • Post-translational
    modifications
    The mature protease can process its own propeptide, but not that of other caspases.
  • Information by UniProt
  • Database links
  • Alternative names
    • CASP-2 antibody
    • Casp2 antibody
    • CASP2_HUMAN antibody
    • Caspase-2 subunit p12 antibody
    • Caspase2 antibody
    • ICH 1L antibody
    • ICH1 antibody
    • ICH1 protease antibody
    • ICH1L antibody
    • ICH1L/1S antibody
    • NEDD-2 antibody
    • NEDD2 antibody
    • Neural precursor cell expressed developmentally down-regulated protein 2 antibody
    • Protease ICH-1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human urinary bladder tissue labeling active Caspase  2 using ab182657 at 1/100 dilution. The right panel is treated with the fusion protein.

  • All lanes : Anti-Caspase 2 antibody (ab182657) at 1/950 dilution

    Lane 1 : Human fetal kidney lysate
    Lane 2 : Human fetal lung lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    Donkey anti Rabbit IgG - H&L (HRP) at 1/3000 dilution

    Predicted band size : 51 kDa


    Exposure time : 2 minutes

    10% SDS PAGE

References

ab182657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up