Anti-Cathepsin Z antibody [AT6G11] (ab187586)

Overview

  • Product name
    Anti-Cathepsin Z antibody [AT6G11]
    See all Cathepsin Z primary antibodies
  • Description
    Mouse monoclonal [AT6G11] to Cathepsin Z
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Cathepsin Z aa 62-303. full length mature protein
    Sequence:

    LPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKG AWPSTLLSVQ NVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCG TCNEFKECHA IRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYA EYQDTTYINH VVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLA IEEHCTFGDP IV


    Database link: Q9UBR2

  • Positive control
    • SW480 and HeLa cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab187586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 33 kDa.

Target

  • Function
    Exhibits carboxy-monopeptidase as well as carboxy-dipeptidase activity.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Carboxypeptidase LB antibody
    • Cathepsin B2 antibody
    • Cathepsin IV antibody
    • Cathepsin P antibody
    • Cathepsin X antibody
    • Cathepsin X precursor antibody
    • Cathepsin Y antibody
    • Cathepsin Z antibody
    • Cathepsin Z precursor antibody
    • Cathepsin Z1 antibody
    • CathepsinP antibody
    • CathepsinX antibody
    • CathepsinZ antibody
    • CATZ_HUMAN antibody
    • CTSX antibody
    • CTSZ antibody
    • Cysteine type carboxypeptidase antibody
    • FLJ17088 antibody
    • Lysosomal carboxypeptidase B antibody
    • Preprocathepsin P antibody
    • PreprocathepsinP antibody
    see all

Images

  • All lanes : Anti-Cathepsin Z antibody [AT6G11] (ab187586) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : SW480 cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 33 kDa

References

ab187586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up