Overview

  • Product name
  • Description
    Rabbit polyclonal to Caveolin-1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Caveolin-1 aa 2-34 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAD


    Database link: Q03135

  • Positive control
    • Mouse lung lysate; Rat RSC96 cells; Mouse eye tissue and Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 20 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/20 - 1/100.

Target

  • Function
    May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.
  • Tissue specificity
    Expressed in muscle and lung, less so in liver, brain and kidney.
  • Involvement in disease
    Defects in CAV1 are the cause of congenital generalized lipodystrophy type 3 (CGL3) [MIM:612526]; also called Berardinelli-Seip congenital lipodystrophy type 3 (BSCL3). Congenital generalized lipodystrophies are autosomal recessive disorders characterized by a near absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes.
  • Sequence similarities
    Belongs to the caveolin family.
  • Post-translational
    modifications
    The initiator methionine for isoform Beta is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.
  • Cellular localization
    Golgi apparatus membrane. Cell membrane. Membrane > caveola. Membrane raft. Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.
  • Information by UniProt
  • Database links
  • Alternative names
    • BSCL3 antibody
    • CAV antibody
    • CAV1 antibody
    • CAV1_HUMAN antibody
    • caveolae protein, 22 kD antibody
    • caveolin 1 alpha isoform antibody
    • caveolin 1 beta isoform antibody
    • Caveolin 1 caveolae protein 22kDa antibody
    • Caveolin-1 antibody
    • Caveolin1 antibody
    • cell growth-inhibiting protein 32 antibody
    • CGL3 antibody
    • LCCNS antibody
    • MSTP085 antibody
    • OTTHUMP00000025031 antibody
    • PPH3 antibody
    • VIP 21 antibody
    • VIP21 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human lung carcinoma tissue labeling Caveolin-1 with ab214448 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-Caveolin-1 antibody (ab214448) at 1/200 dilution

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Mouse muscle tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution

    Predicted band size: 20 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Mouse eye tissue labeling Caveolin-1 with ab214448 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Flow cytometric analysis of Rat RSC96 cells labeling Caveolin-1 with ab214448 at 1/100 dilution followed by conjugated secondary (PE Conjugated) (green) compared to control cells (blue), secondary only (light blue) and isotype control (orange).

References

ab214448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up