Overview

  • Product nameAnti-CCDC138 antibody
    See all CCDC138 primary antibodies
  • Description
    Rabbit polyclonal to CCDC138
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    A synthetic peptide corresponding to a region within the N-terminal sequence 2-51 (

    EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

    ) of Human CCDC138 (NP_659415).

  • Positive control
    • 721_B cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • RelevanceThere are two named isoforms. The function of the CCDC138 protein remains unknown.
  • Database links
  • Alternative names
    • CCDC 138 antibody
    • CCDC138 antibody
    • Coiled coil domain containing 138 antibody
    • Coiled coil domain containing protein 138 antibody
    • FLJ 32745 antibody
    • FLJ32745 antibody
    see all

Anti-CCDC138 antibody images

  • Anti-CCDC138 antibody (ab83826) at 1 µg/ml (in 5% skim milk / PBS buffer) + 10ug 721_B cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 76 kDa
    Observed band size : 67 kDa (why is the actual band size different from the predicted?)
    Additional bands at : ~40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-CCDC138 antibody (ab83826)

ab83826 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"