Overview

  • Product name
  • Description
    Rabbit polyclonal to CCDC15
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: DKNKPFSRVQKVKFKNPLFVLMEEEEQKQLHFEGLQDILPEAQDYFLEAQ GDLLETQGDLTGIQ SVKPDTQAVEMKVQVT, corresponding to amino acids 291-370 of Human CCDC15 (Q0P6D6).

  • Positive control
    • Human colon tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at -20ºC.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Anti-CCDC15 antibody images

  • Immunofluorescent staining of Human cell line U-251 MG shows positivity in cytoplasm and microtubule organizing center. Recommended concentration of ab122651 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122651, at 1/200, staining CCDC15 in paraffin embedded Human colon tissue by Immunohistochemistry.

References for Anti-CCDC15 antibody (ab122651)

ab122651 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up