Anti-CCDC48 antibody - C-terminal (ab177450)

Overview

  • Product name
    Anti-CCDC48 antibody - C-terminal
    See all CCDC48 primary antibodies
  • Description
    Rabbit polyclonal to CCDC48 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CCDC48 aa 319-368 (C terminal). The exact sequence is proprietary. (NP_079044.2).
    Sequence:

    LEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDPTPEGAWQS


    Database link: Q9HA90

  • Positive control
    • HT1080 whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa.

Target

  • Relevance
    The function of this protein remains unknown.
  • Database links
  • Alternative names
    • C3orf73 antibody
    • CCDC48 antibody
    • Coiled coil domain containing 48 antibody
    • Coiled coil domain containing protein 48 antibody
    • EF hand and coiled coil domain containing 1 antibody
    • EF hand and coiled coil domain containing protein 1 antibody
    • EF hand domain containing protein ENSP00000381169 antibody
    • EFCC1 antibody
    • EFCC1_HUMAN antibody
    see all

Images

  • Anti-CCDC48 antibody - C-terminal (ab177450) at 1 µg/ml + HT1080 whole cell lysate at 10 µg

    Predicted band size : 66 kDa

    5% milk block used

References

ab177450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up