Overview

  • Product name
    Anti-CCDC54 antibody
  • Description
    Rabbit polyclonal to CCDC54
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CCDC54 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    TDLYQKQMEVLETRMNVNEDKQCTTTKDILS


    Database link: Q8NEL0

  • Positive control
    • NCI-H460 cell lysate, Human uterus tissue, NCI-H460 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99.91% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab170357 is purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/500. Predicted molecular weight: 38 kDa.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Relevance
    The specific function of CCDC54 (coiled-coil domain containing 54) is not yet known. The CCDC54 gene appears to be conserved in chimpanzee, dog, mouse, and rat.
  • Database links
  • Alternative names
    • Coiled-coil domain containing 54 antibody
    • Coiled-coil domain-containing protein 54 antibody
    • FLJ25362 antibody
    • NYD-SP17 antibody
    • SP17 antibody
    • sperm protein 17 antibody
    • Testes development-related NYD-SP17 antibody
    • Testis development protein NYD-SP17 antibody
    see all

Images

  • Flow cytometry analysis of NCI-H460 cells labeling CCDC54 (green, right histogram), using ab170357 at a 1/10 dilution, and negative control cells (blue, left histogram). FITC-conjugated goat-anti-rabbit secondary antibodies was used for the analysis.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human uterus tissue, labeling CCDC54  using ab170357 at a 1/50 dilution, followed by peroxidase conjugation of the secondary antibody and DAB staining.

  • Anti-CCDC54 antibody (ab170357) at 1/100 dilution + NCI-H460 cell lysate at 35 µg

    Predicted band size: 38 kDa

References

ab170357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up