Overview

  • Product name
    Anti-CCDC61 antibody
  • Description
    Rabbit polyclonal to CCDC61
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CCDC61 aa 325-369 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RGRGRPARPSPSPTGGRALRFDPTAFVKAKERKQREIQMKQQQRN


    Database link: Q9Y6R9

  • Positive control
    • Rat brain and Mouse embryo tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 57 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Rat brain labeling CCDC61 with ab203631 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Mouse embryo labeling CCDC61 with ab203631 at 1/200 followed by conjugation to the secondary antibody Cy3 conjugated Goat anti-Rabbit IgG used at 1/200 dilution for 40 minutes at 37°C. DAPI (5µg/ml) was used to stain the cell nuclei.

References

ab203631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up