
  • Product nameAnti-CCDC67 antibody
    See all CCDC67 primary antibodies
  • Description
    Rabbit polyclonal to CCDC67
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 36-85 (WERKMRALETRLDLRDQELANAQTCLDQKGQEVGLLRQKLDSLEKCNLA M) of Human CCDC67, NP_857596

  • Positive control
    • 721_B cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab81515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.


Anti-CCDC67 antibody images

  • Anti-CCDC67 antibody (ab81515) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)

References for Anti-CCDC67 antibody (ab81515)

ab81515 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81515.
Please use the links above to contact us or submit feedback about this product.