Anti-CCDC68 antibody - N-terminal (ab188021)

Overview

  • Product name
    Anti-CCDC68 antibody - N-terminal
    See all CCDC68 primary antibodies
  • Description
    Rabbit Polyclonal to CCDC68 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC68 aa 1-84 (N terminal).
    Sequence:

    MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQ MFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS


    Database link: Q9H2F9

  • Positive control
    • Human colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity
    Expressed in bone marrow, colon, small intestine, spleen, testis, trachea and cutaneous T-cell lymphoma (CTCL).
  • Information by UniProt
  • Database links
  • Alternative names
    • CCD68_HUMAN antibody
    • CCDC 68 antibody
    • CCDC68 antibody
    • Coiled coil domain containing 68 antibody
    • Coiled coil domain containing protein 68 antibody
    • Coiled-coil domain-containing protein 68 antibody
    • CTCL associated antigen se57 1 antibody
    • CTCL tumor antigen se57 1 antibody
    • CTCL-associated antigen se57-1 antibody
    • Cutaneous T cell lymphoma associated antigen antibody
    • Cutaneous T cell lymphoma associated antigen se57 1 antibody
    • Cutaneous T-cell lymphoma-associated antigen se57-1 antibody
    • FLJ25368 antibody
    • SE57 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling CCDC68 with ab188021 at 1/200 dilution.

References

ab188021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up