Anti-CCN1 antibody [RM0407-9B32] (ab205695)

Overview

  • Product name
    Anti-CCN1 antibody [RM0407-9B32]
    See all CCN1 primary antibodies
  • Description
    Rat monoclonal [RM0407-9B32] to CCN1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Human, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Mouse CCN1 aa 176-281.
    Sequence:

    DDLLGLDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHAHGQ KCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVY SSLKKG


    Database link: P18406

  • Positive control
    • Mouse heart tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab205695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 42 kDa.

Target

  • Function
    Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
  • Sequence similarities
    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3CH61 antibody
    • CCN 1 antibody
    • CCN family member 1 antibody
    • CYR 61 antibody
    • Cyr61 antibody
    • CYR61 protein antibody
    • CYR61_HUMAN antibody
    • Cysteine rich angiogenic inducer 61 antibody
    • Cysteine rich heparin binding protein 61 antibody
    • Cysteine-rich angiogenic inducer 61 antibody
    • GIG 1 antibody
    • GIG1 antibody
    • IBP-10 antibody
    • IGF-binding protein 10 antibody
    • Igfbp 10 antibody
    • IGFBP-10 antibody
    • Igfbp10 antibody
    • Insulin like growth factor binding protein 10 antibody
    • Insulin-like growth factor-binding protein 10 antibody
    • Protein CYR61 antibody
    • Protein GIG1 antibody
    see all

Images

  • Anti-CCN1 antibody [RM0407-9B32] (ab205695) at 1/1000 dilution + Mouse heart tissue lysates

    Predicted band size : 42 kDa

References

ab205695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up