Anti-CCNB1IP1 antibody - Aminoterminal end (ab171035)

Overview

  • Product name
    Anti-CCNB1IP1 antibody - Aminoterminal end
    See all CCNB1IP1 primary antibodies
  • Description
    Rabbit polyclonal to CCNB1IP1 - Aminoterminal end
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse CCNB1IP1 aa 4-53 (N terminal). The exact sequence is proprietary.
    Sequence:

    CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS


    Database link: NP_001104589

  • Positive control
    • Mouse thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function
    E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
  • Tissue specificity
    Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated; autoubiquitinated.
    Phosphorylated by CDK1 on serine or threonine residues (in vitro).
  • Cellular localization
    Nucleus. Chromosome. May associate with segregating chromosomes during metaphase and anaphase.
  • Information by UniProt
  • Database links
  • Alternative names
    • C14orf18 antibody
    • CCNB1IP1 antibody
    • Chromosome 14 open reading frame 18 antibody
    • CIP1_HUMAN antibody
    • Cyclin B1 interacting protein 1 antibody
    • cyclin B1 interacting protein 1, E3 ubiquitin protein ligase antibody
    • Cyclin-B1-interacting protein 1 antibody
    • E3 ubiquitin-protein ligase CCNB1IP1 antibody
    • Enhancer of invasion 10 antibody
    • Gm288 antibody
    • HEI10 antibody
    • Human enhancer of invasion 10 antibody
    • mei4 antibody
    see all

Images

  • Anti-CCNB1IP1 antibody - Aminoterminal end (ab171035) at 1 µg/ml + mouse thymus lysate at 10 µg

    Predicted band size : 31 kDa

References

ab171035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up