Overview

  • Product name
    CD133 protein
  • Protein length
    Full length protein
  • Description
    Recombinant Human CD133 protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAG PIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKIVYYEAGI ILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFA ISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETP EQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSM ATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLV HPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQ GYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAF SVYVNNTESYIHRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCG VCGYDRHATPTTRGCVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGA NVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQV YSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFL LGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKAN SLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGL LERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEF SISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPAL IFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVM TSPSQH
    • Molecular weight
      123 kDa including tags
    • Amino acids
      1 to 856
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      AAH12089.1.

Specifications

Our Abpromise guarantee covers the use of ab160218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • AC133
    • Antigen AC133
    • CD133
    • CORD12
    • Hematopoietic stem cell antigen
    • hProminin
    • MCDR2
    • MSTP061
    • OTTHUMP00000217744
    • OTTHUMP00000217745
    • OTTHUMP00000217746
    • PROM1
    • PROM1_HUMAN
    • Prominin I
    • Prominin like 1
    • Prominin like protein 1 precursor
    • Prominin mouse like 1
    • Prominin-1
    • Prominin-like protein 1
    • Prominin1
    • PROML1
    • RP41
    • STGD4
    see all
  • Function
    May play a role in cell differentiation, proliferation and apoptosis (PubMed:24556617). Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner (PubMed:20818439).
  • Tissue specificity
    Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number of non-lymphoid tissues including retina, pancreas, placenta, kidney, liver, lung, brain and heart. Found in saliva within small membrane particles. Isoform 2 is predominantly expressed in fetal liver, skeletal muscle, kidney, and heart as well as adult pancreas, kidney, liver, lung, and placenta. Isoform 2 is highly expressed in fetal liver, low in bone marrow, and barely detectable in peripheral blood. Isoform 2 is expressed on hematopoietic stem cells and in epidermal basal cells (at protein level). Expressed in adult retina by rod and cone photoreceptor cells (at protein level).
  • Involvement in disease
    Retinitis pigmentosa 41
    Cone-rod dystrophy 12
    Stargardt disease 4
    Retinal macular dystrophy 2
  • Sequence similarities
    Belongs to the prominin family.
  • Post-translational
    modifications
    Isoform 1 and isoform 2 are glycosylated.
    Acetylation at Lys-225, Lys-257 and Lys-264 by NAT8 and NAT8B may control PROM1 protein expression and its function in cell apoptosis.
  • Cellular localization
    Apical cell membrane. Cell projection, microvillus membrane. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Found in extracellular membrane particles in various body fluids such as cerebrospinal fluid, saliva, seminal fluid and urine.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab160218 stained with Coomassie Blue.

References

ab160218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up