Overview

  • Product name
    Anti-CD146 antibody [6C3F1]
    See all CD146 primary antibodies
  • Description
    Mouse monoclonal [6C3F1] to CD146
  • Tested applications
    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD146 aa 84-189. Expressed in E. Coli.
    Sequence:

    EPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVY KAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKE EKNRVH


    Database link: P43121

  • Positive control
    • Hela cell lysate; CD146 recombinant protein; CD146 (aa 84-189)-hIgGFc transfected HEK293 cell lysate; Human liver cancer and Human kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab181769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 72 kDa.
ELISA 1/1000.

Target

  • Function
    Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2, and a transient increase in the intracellular calcium concentration.
  • Tissue specificity
    Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.
  • Sequence similarities
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • A32 antigen antibody
    • CD 146 antibody
    • CD146 antibody
    • CD146 antigen antibody
    • Cell surface glycoprotein MUC18 antibody
    • Cell surface glycoprotein P1H12 antibody
    • Gicerin antibody
    • Mcam antibody
    • Melanoma adhesion molecule antibody
    • Melanoma associated antigen A32 antibody
    • Melanoma associated antigen MUC18 antibody
    • Melanoma associated glycoprotein MUC18 antibody
    • Melanoma cell adhesion molecule antibody
    • Melanoma-associated antigen A32 antibody
    • Melanoma-associated antigen MUC18 antibody
    • MelCAM antibody
    • MUC 18 antibody
    • MUC18 antibody
    • MUC18_HUMAN antibody
    • S endo 1 antibody
    • S endo 1 endothelial associated antigen antibody
    • S-endo 1 endothelial-associated antigen antibody
    see all

Images

  • Anti-CD146 antibody [6C3F1] (ab181769) at 1/500 dilution + HeLa cell lysate

    Predicted band size : 72 kDa
  • All lanes : Anti-CD146 antibody [6C3F1] (ab181769) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with CD146 (aa 84-189)-hIgGFc


    Predicted band size : 72 kDa
  • Anti-CD146 antibody [6C3F1] (ab181769) at 1/500 dilution + CD146 recombinant protein

    Predicted band size : 72 kDa
  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling CD146 with ab181769 at 1/200 dilution followed by DAB staining.

  • Immunohistochemical analysis of paraffin embedded Human liver cancer tissue labeling CD146 with ab181769 at 1/200 dilution followed by DAB staining.

References

ab181769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up