Overview

  • Product name
    Anti-CD168 antibody - N-terminal
    See all CD168 primary antibodies
  • Description
    Rabbit polyclonal to CD168 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CD168 aa 1-300 (N terminal).
    Sequence:

    MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKES KQNLNVDKDTTLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGA QDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQLIELTRTNELL KSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQR SLEESQGKIAQLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKY KLDIAQLEENLKEKNDEILSLKQSLEENIVILSKQVEDLNVKCQLLEKEK


    Database link: O75330

  • Positive control
    • SW480, HeLa, Jurkat, Romas and ES-2 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab185728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 84 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including the focal adhesion kinase occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular-regulated kinase (ERK) activity.
  • Tissue specificity
    Expressed in breast cancer cell lines and in normal breast tissue.
  • Cellular localization
    Cell surface. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD168 antibody
    • CD168 antigen antibody
    • HMMR antibody
    • HMMR_HUMAN antibody
    • Hyaluronan mediated motility receptor antibody
    • Hyaluronan-mediated motility receptor (RHAMM) antibody
    • IHABP antibody
    • Intracellular hyaluronic acid-binding protein antibody
    • MGC119494 antibody
    • MGC119495 antibody
    • OTTHUMP00000196920 antibody
    • Receptor for hyaluronan-mediated motility antibody
    • RHAMM antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185728. Blue DAPI for nuclear staining.
  • All lanes : Anti-CD168 antibody - N-terminal (ab185728) at 1/500 dilution

    Lane 1 : SW840 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : Ramos cell lysate
    Lane 5 : ES-2 cell lysate

    Predicted band size: 84 kDa

References

This product has been referenced in:
  • Oldenburg D  et al. CD44 and RHAMM are essential for rapid growth of bladder cancer driven by loss of Glycogen Debranching Enzyme (AGL). BMC Cancer 16:713 (2016). WB, ICC/IF ; Human . Read more (PubMed: 27595989) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up