Overview

  • Product nameAnti-CD299 antibody
    See all CD299 primary antibodies
  • Description
    Rabbit polyclonal to CD299
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 323-372 (

    NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS

    ) of Human CD299 (NP_055072).

  • Positive control
    • Human fetal kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionProbable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a coreceptor for the SARS coronavirus.
  • Tissue specificityPredominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • DomainThe tandem repeat domain, also called neck domain, mediates oligomerization.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C type lectin domain family 4, member M antibody
    • C-type lectin domain family 4 member M antibody
    • CD209 antigen like antibody
    • CD209 antigen like protein 1 antibody
    • CD209 antigen-like protein 1 antibody
    • CD209L antibody
    • CD209L1 antibody
    • CD299 antibody
    • CD299 antigen antibody
    • CLC4M_HUMAN antibody
    • CLEC4M antibody
    • DC SIGN related protein antibody
    • DC SIGN2 antibody
    • DC SIGNR antibody
    • DC-SIGN-related protein antibody
    • DC-SIGN2 antibody
    • DC-SIGNR antibody
    • DCSIGN related protein antibody
    • DCSIGNR antibody
    • Dendritic cell-specific ICAM-3-grabbing non-integrin 2 antibody
    • HP10347 antibody
    • L SIGN antibody
    • L-SIGN antibody
    • Liver/lymph node specific ICAM3 grabbing nonintegrin antibody
    • Liver/lymph node-specific ICAM-3-grabbing non-integrin antibody
    • LSIGN antibody
    • Mannose binding C type lectin DC SIGNR antibody
    • MGC129964 antibody
    • MGC47866 antibody
    see all

Anti-CD299 antibody images

  • Anti-CD299 antibody (ab102060) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size : 45 kDa

References for Anti-CD299 antibody (ab102060)

ab102060 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"