Anti-CD3 zeta antibody [4A12-F6] (ab188850)

Overview

  • Product name
    Anti-CD3 zeta antibody [4A12-F6]
    See all CD3 zeta primary antibodies
  • Description
    Mouse monoclonal [4A12-F6] to CD3 zeta
  • Tested applications
    Suitable for: Sandwich ELISA, WB, IHC-P, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human CD3 zeta aa 1-164. (AAH25703).
    Sequence:

    MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALF LRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR


    Database link: P20963

  • Positive control
    • Human spleen and thymus tissues; CD3 zeta transfected 293T cell lysate; Jurkat cell lysate.
  • General notes

    Abcam is committed to meeting high standards of ethical manufacturing and has decided to discontinue this product by June 2019 as it has been generated by the ascites method. We are sorry for any inconvenience this may cause. We would recommend antibody ab190728 as a replacement.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    4A12-F6
  • Isotype
    IgG1
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use at an assay dependent concentration.
WB 1/500 - 1/1000. Predicted molecular weight: 19 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
IP Use at an assay dependent concentration.

Target

  • Function
    Probable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
  • Involvement in disease
    Defects in CD247 are the cause of immunodeficiency due to defect in CD3-zeta (CD3ZID) [MIM:610163]. An immunological deficiency characterized by T-cells impaired immune response to alloantigens, tetanus toxoid and mitogens.
  • Sequence similarities
    Belongs to the CD3Z/FCER1G family.
    Contains 3 ITAM domains.
  • Domain
    The ITAM domains mediate interaction with SHB.
  • Post-translational
    modifications
    Phosphorylated on Tyr residues after T-cell receptor triggering.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4930549J05Rik antibody
    • A430104F18Rik antibody
    • AW552088 antibody
    • CD247 antibody
    • CD247 antigen antibody
    • Cd247 molecule antibody
    • Cd3 antibody
    • CD3 antigen, zeta polypeptide, isoform CRA_b antibody
    • CD3 antigen, zeta subunit antibody
    • CD3-eta antibody
    • CD3H antibody
    • CD3Q antibody
    • Cd3z antibody
    • CD3Z antigen zeta polypeptide (TiT3 complex) antibody
    • CD3Z_HUMAN antibody
    • CD3zeta antibody
    • CD3zeta chain antibody
    • MGC140430 antibody
    • T cell receptor T3 zeta chain antibody
    • T cell surface glycoprotein CD3 zeta chain antibody
    • T-cell antigen receptor complex, zeta subunit of CD3 antibody
    • T-cell receptor T3 zeta chain antibody
    • T-cell surface glycoprotein CD3 zeta chain antibody
    • T3z antibody
    • TCR zeta chain antibody
    • TCRk antibody
    • TCRZ antibody
    • TCRzeta antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human thymus tissue labeling CD3 zeta with ab188850 at 5 µg/ml.

  • All lanes : Anti-CD3 zeta antibody [4A12-F6] (ab188850) at 1/500 dilution

    Lane 1 : CD3 zeta transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate


    Predicted band size : 19 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human spleen tissue labeling CD3 zeta with ab188850 at 5 µg/ml.

  • Anti-CD3 zeta antibody [4A12-F6] (ab188850) at 1/500 dilution + Jurkat cell lysate

    Predicted band size : 19 kDa
  • Immunoprecipitation of CD3 zeta transfected lysate using ab188850 and Protein A Magnetic Beads.

References

ab188850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up